MitoKor – Human Mitochondrial Genomes

MITOMAP GOBASE dataset is composed genome sequences analysis of coding DNA

fallback-image

Igm Antibody For

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Ana Laboratories manufactures the igm antibody for reagents distributed by Genprice. The Igm Antibody For reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igm antibody. Other Igm products are available in stock. Specificity: Igm Category: Antibody Group: For

True north Cryobox 15mLBlue

PK10
EUR 212.4

True north Cryobox 50mLNatural

PK10
EUR 210

True north Cryobox 50mLBlue

PK10
EUR 210

True north Cryobox1.5/2mLNatural

PK10
EUR 162

True north Cryobox1.5/2.0mLGreen

PK10
EUR 162

True north Cryobox 1.5/2.0mLBlue

PK10
EUR 100.8

True north Cryobox 1.5/2.0mLBlue

PK10
EUR 162

For information

ELISA kit for Rat Anti-toxoplasmosis (IgM) Antibody

KTE100944-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Rat Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Anti-toxoplasmosis (IgM) Antibody

KTE100944-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Rat Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Brucella Antibody IgM (Brucella-Ab-IgM)

KTE62702-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human Brucella Antibody IgM (Brucella-Ab-IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Brucella Antibody IgM (Brucella-Ab-IgM)

KTE62702-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human Brucella Antibody IgM (Brucella-Ab-IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Brucella Antibody IgM (Brucella-Ab-IgM)

KTE62702-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human Brucella Antibody IgM (Brucella-Ab-IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody

KTE110059-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody

KTE110059-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody

KTE110059-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Bordetella pertussis IgM antibody

KTE62573-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Bordetella pertussis IgM antibody

KTE62573-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Bordetella pertussis IgM antibody

KTE62573-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA Kit for Antibody IgM to Toxoplasmosis

Z7010004 1 kit
EUR 247

ELISA Kit for Antibody IgM to Cytomegalovirus

Z7010001 1 kit
EUR 247

ELISA Kit for IgM Antibody to Hepatitis A Virus

KO31008096 1 kit
EUR 247

ELISA Kit for IgM Antibody to Hepatitis E Virus

Z7010009 1 kit
EUR 652

ELISA kit for Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM)

KTE100956-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM)

KTE100956-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Recent Posts

Categories

November 2023
M T W T F S S
 12345
6789101112
13141516171819
20212223242526
27282930  

Tags