Monoclonal antibody for SUR1 and SUR2B |
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Ana Laboratories manufactures the igm antibody for reagents distributed by Genprice. The Igm Antibody For reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igm antibody. Other Igm products are available in stock. Specificity: Igm Category: Antibody Group: For
JBS True Blue |
MiTeGen |
300 µl |
EUR 16 |
Description: JBS True Blue |
Sheep True insulin ELISA kit |
BlueGene |
96T |
EUR 700 |
Description: ELISA |
For information
ELISA kit for Human Brucella Antibody IgM (Brucella-Ab-IgM) |
KTE62702-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2702.4 |
|
Description: Quantitative sandwich ELISA for measuring Human Brucella Antibody IgM (Brucella-Ab-IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Brucella Antibody IgM (Brucella-Ab-IgM) |
KTE62702-96T |
Abbkine |
96T |
EUR 686.4 |
|
Description: Quantitative sandwich ELISA for measuring Human Brucella Antibody IgM (Brucella-Ab-IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody |
KTE110059-48T |
Abbkine |
48T |
EUR 424.8 |
|
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody |
KTE110059-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2702.4 |
|
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody |
KTE110059-96T |
Abbkine |
96T |
EUR 686.4 |
|
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA Kit for Antibody IgM to Toxoplasmosis |
Z7010004 |
Biochain |
1 kit |
EUR 247 |
ELISA kit for Human Bordetella pertussis IgM antibody |
KTE62573-48T |
Abbkine |
48T |
EUR 424.8 |
|
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Bordetella pertussis IgM antibody |
KTE62573-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2702.4 |
|
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Human Bordetella pertussis IgM antibody |
KTE62573-96T |
Abbkine |
96T |
EUR 686.4 |
|
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA Kit for Antibody IgM to Cytomegalovirus |
Z7010001 |
Biochain |
1 kit |
EUR 284 |
ELISA Kit for IgM Antibody to Hepatitis A Virus |
KO31008096 |
Biochain |
1 kit |
EUR 284 |
ELISA Kit for IgM Antibody to Hepatitis E Virus |
Z7010009 |
Biochain |
1 kit |
EUR 750 |
ELISA kit for Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) |
KTE100956-48T |
Abbkine |
48T |
EUR 424.8 |
|
Description: Quantitative sandwich ELISA for measuring Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) |
KTE100956-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2702.4 |
|
Description: Quantitative sandwich ELISA for measuring Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) |
KTE100956-96T |
Abbkine |
96T |
EUR 686.4 |
|
Description: Quantitative sandwich ELISA for measuring Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Mouse Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) |
KTE71518-48T |
Abbkine |
48T |
EUR 398.4 |
|
Description: Quantitative sandwich ELISA for measuring Mouse Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |
ELISA kit for Mouse Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) |
KTE71518-5platesof96wells |
Abbkine |
5 plates of 96 wells |
EUR 2538 |
|
Description: Quantitative sandwich ELISA for measuring Mouse Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids. |