MitoKor – Human Mitochondrial Genomes

MITOMAP GOBASE dataset is composed genome sequences analysis of coding DNA

fallback-image

Igm Antibody For

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Ana Laboratories manufactures the igm antibody for reagents distributed by Genprice. The Igm Antibody For reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igm antibody. Other Igm products are available in stock. Specificity: Igm Category: Antibody Group: For

True Blue

5x5(mg
EUR 2705

JBS True Blue

300µl
EUR 13.7

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

JBS True Blue

300 µl
EUR 16
Description: JBS True Blue

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

For information

ELISA kit for Chicken Marek's disease virus IgM antibody (MDV-Ab-IgM)

KTE30165-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Chicken Marek's disease virus IgM antibody (MDV-Ab-IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Chicken Marek's disease virus IgM antibody (MDV-Ab-IgM)

KTE30165-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Chicken Marek's disease virus IgM antibody (MDV-Ab-IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody

KTE110059-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody

KTE110059-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody

KTE110059-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA Kit for Antibody IgM to Toxoplasmosis

Z7010004 1 kit
EUR 247

ELISA kit for Human Bordetella pertussis IgM antibody

KTE62573-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Bordetella pertussis IgM antibody

KTE62573-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Bordetella pertussis IgM antibody

KTE62573-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA Kit for Antibody IgM to Cytomegalovirus

Z7010001 1 kit
EUR 284

ELISA Kit for IgM Antibody to Hepatitis E Virus

Z7010009 1 kit
EUR 750

ELISA Kit for IgM Antibody to Hepatitis A Virus

KO31008096 1 kit
EUR 284

ELISA kit for Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM)

KTE100956-48T 48T
EUR 424.8
Description: Quantitative sandwich ELISA for measuring Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM)

KTE100956-5platesof96wells 5 plates of 96 wells
EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM)

KTE100956-96T 96T
EUR 686.4
Description: Quantitative sandwich ELISA for measuring Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM)

KTE71518-48T 48T
EUR 398.4
Description: Quantitative sandwich ELISA for measuring Mouse Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM)

KTE71518-5platesof96wells 5 plates of 96 wells
EUR 2538
Description: Quantitative sandwich ELISA for measuring Mouse Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Recent Posts

Categories

September 2024
M T W T F S S
 1
2345678
9101112131415
16171819202122
23242526272829
30  

Tags