Monoclonal antibody for SUR1 and SUR2B
SMC-432D	Stressmarq	0.1mg	EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Ana Laboratories manufactures the igm antibody for reagents distributed by Genprice. The Igm Antibody For reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact igm antibody. Other Igm products are available in stock. Specificity: Igm Category: Antibody Group: For

True north Cryobox 15mLBlue
Scientific Laboratory Supplies	PK10	EUR 212.4

True north Cryobox 50mLNatural
Scientific Laboratory Supplies	PK10	EUR 210

True north Cryobox 50mLBlue
Scientific Laboratory Supplies	PK10	EUR 210

True north Cryobox1.5/2mLNatural
Scientific Laboratory Supplies	PK10	EUR 162

True north Cryobox1.5/2.0mLGreen
Scientific Laboratory Supplies	PK10	EUR 162

True north Cryobox 1.5/2.0mLBlue
Scientific Laboratory Supplies	PK10	EUR 100.8

True north Cryobox 1.5/2.0mLBlue
Scientific Laboratory Supplies	PK10	EUR 162

For information

ELISA kit for Rat Anti-toxoplasmosis (IgM) Antibody
KTE100944-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Rat Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Anti-toxoplasmosis (IgM) Antibody
KTE100944-96T	Abbkine	96T	EUR 686.4
Description: Quantitative sandwich ELISA for measuring Rat Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Brucella Antibody IgM (Brucella-Ab-IgM)
KTE62702-48T	Abbkine	48T	EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human Brucella Antibody IgM (Brucella-Ab-IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Brucella Antibody IgM (Brucella-Ab-IgM)
KTE62702-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human Brucella Antibody IgM (Brucella-Ab-IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Brucella Antibody IgM (Brucella-Ab-IgM)
KTE62702-96T	Abbkine	96T	EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human Brucella Antibody IgM (Brucella-Ab-IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody
KTE110059-48T	Abbkine	48T	EUR 424.8
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody
KTE110059-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Sheep Anti-toxoplasmosis (IgM) Antibody
KTE110059-96T	Abbkine	96T	EUR 686.4
Description: Quantitative sandwich ELISA for measuring Sheep Anti-toxoplasmosis (IgM) Antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Bordetella pertussis IgM antibody
KTE62573-48T	Abbkine	48T	EUR 424.8
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Bordetella pertussis IgM antibody
KTE62573-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Bordetella pertussis IgM antibody
KTE62573-96T	Abbkine	96T	EUR 686.4
Description: Quantitative sandwich ELISA for measuring Human Bordetella pertussis IgM antibody in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA Kit for Antibody IgM to Toxoplasmosis
Z7010004	Biochain	1 kit	EUR 247

ELISA Kit for Antibody IgM to Cytomegalovirus
Z7010001	Biochain	1 kit	EUR 247

ELISA Kit for IgM Antibody to Hepatitis A Virus
KO31008096	Biochain	1 kit	EUR 247

ELISA Kit for IgM Antibody to Hepatitis E Virus
Z7010009	Biochain	1 kit	EUR 652

ELISA kit for Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM)
KTE100956-48T	Abbkine	48T	EUR 424.8
Description: Quantitative sandwich ELISA for measuring Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM)
KTE100956-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2702.4
Description: Quantitative sandwich ELISA for measuring Rat Phosphatidylinositol antibody IgG/IgM (PI Ab-IgG/IgM) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.